PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00001.409
Common NameAMTR_s00001p00266470, LOC18424466
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family MIKC_MADS
Protein Properties Length: 224aa    MW: 25524.4 Da    PI: 9.9379
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00001.409genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.72e-30959151
                                              S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                                    SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                              krien + rqvtfskRrng+lKKA+ELSvLCdaeva+i+fs++gkl+e+ss
  evm_27.model.AmTr_v1.0_scaffold00001.409  9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLHEFSS 59
                                              79***********************************************96 PP

2K-box85.98.3e-2982170997
                                     K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqi 77 
                                                 e+ +++++ e+a + k+ie L+ ++R+llGe+L+s+s++eLq++e+qLe+sl++iR +K+ +l+eqi
  evm_27.model.AmTr_v1.0_scaffold00001.409  82 ILEQSMQHWKYEAATMAKKIELLEFSKRKLLGESLDSCSVEELQHIESQLERSLSSIRGRKTAMLMEQI 150
                                               567889*************************************************************** PP

                                     K-box  78 eelqkkekelqeenkaLrkk 97 
                                               e+l++kek l+ en +L++k
  evm_27.model.AmTr_v1.0_scaffold00001.409 151 EKLKEKEKVLSAENAMLSEK 170
                                               *****************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.8E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.735161IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-30323IPR002100Transcription factor, MADS-box
CDDcd002659.75E-43374No hitNo description
SuperFamilySSF554551.44E-33374IPR002100Transcription factor, MADS-box
PfamPF003197.3E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-303859IPR002100Transcription factor, MADS-box
PfamPF014861.0E-2785171IPR002487Transcription factor, K-box
PROSITE profilePS5129715.09787177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000060Biological Processprotein import into nucleus, translocation
GO:0009409Biological Processresponse to cold
GO:0009739Biological Processresponse to gibberellin
GO:0009911Biological Processpositive regulation of flower development
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MVRGKTQMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALIVFSP RGKLHEFSSS  60
NMQKTIERYQ RYSKEVGMNG KILEQSMQHW KYEAATMAKK IELLEFSKRK LLGESLDSCS  120
VEELQHIESQ LERSLSSIRG RKTAMLMEQI EKLKEKEKVL SAENAMLSEK CGIPQTPLRD  180
NRKSTVSYIT SSEHVDVETD LYIGRPESAR GRYTVQVIAD GNK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P5e-20184186Myocyte-specific enhancer factor 2B
1tqe_Q5e-20184186Myocyte-specific enhancer factor 2B
1tqe_R5e-20184186Myocyte-specific enhancer factor 2B
1tqe_S5e-20184186Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00076ChIP-chipTransfer from AT2G45660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006829116.11e-164PREDICTED: MADS-box protein SOC1 isoform X2
SwissprotO646452e-84SOC1_ARATH; MADS-box protein SOC1
TrEMBLW1NL131e-164W1NL13_AMBTC; Uncharacterized protein
STRINGGLYMA18G45780.12e-88(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.11e-85AGAMOUS-like 20
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]